ASS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578021
Artikelname: ASS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578021
Hersteller Artikelnummer: orb578021
Alternativnummer: BYT-ORB578021-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ASS
Konjugation: Unconjugated
Alternative Synonym: ASS, CTLN1
Rabbit polyclonal antibody to ASS
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 47 kDa
NCBI: 446464
UniProt: P00966
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
Target-Kategorie: ASS1