Insr antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB578024
Artikelname: |
Insr antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB578024 |
Hersteller Artikelnummer: |
orb578024 |
Alternativnummer: |
BYT-ORB578024-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse |
Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Konjugation: |
Unconjugated |
Alternative Synonym: |
I, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik |
Rabbit polyclonal antibody to Insr |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Molekulargewicht: |
155kDa |
NCBI: |
034698 |
UniProt: |
P15208 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY |
Target-Kategorie: |
Insr |