Insr antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578024
Artikelname: Insr antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578024
Hersteller Artikelnummer: orb578024
Alternativnummer: BYT-ORB578024-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Unconjugated
Alternative Synonym: I, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik
Rabbit polyclonal antibody to Insr
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 155kDa
NCBI: 034698
UniProt: P15208
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY
Target-Kategorie: Insr