MYBPC3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578027
Artikelname: MYBPC3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578027
Hersteller Artikelnummer: orb578027
Alternativnummer: BYT-ORB578027-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MYBPC3
Konjugation: Unconjugated
Alternative Synonym: FHC, CMH4, CMD1MM, LVNC10, MYBP-C, cMyBP-C
Rabbit polyclonal antibody to MYBPC3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 141 kDa
NCBI: 000247
UniProt: Q14896
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVS
Target-Kategorie: MYBPC3