PTH antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578030
Artikelname: PTH antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578030
Hersteller Artikelnummer: orb578030
Alternativnummer: BYT-ORB578030-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PTH1R
Konjugation: Unconjugated
Alternative Synonym: PFE, EKNS, PTHR, PTHR1
Rabbit polyclonal antibody to PTH
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 000307
UniProt: Q03431
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLK
Target-Kategorie: PTH1R