TNNI3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578033
Artikelname: TNNI3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578033
Hersteller Artikelnummer: orb578033
Alternativnummer: BYT-ORB578033-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNNI3
Konjugation: Unconjugated
Alternative Synonym: CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF
Rabbit polyclonal antibody to TNNI3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 23kDa
NCBI: 000354
UniProt: Q59H18
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
Target-Kategorie: TNNI3