HRG antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578036
Artikelname: HRG antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578036
Hersteller Artikelnummer: orb578036
Alternativnummer: BYT-ORB578036-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HRG
Konjugation: Unconjugated
Alternative Synonym: HPRG, HRGP, THPH11
Rabbit polyclonal antibody to HRG
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 60kDa
NCBI: 000403
UniProt: P04196
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM
Target-Kategorie: HRG