MAT1A antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578037
Artikelname: MAT1A antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578037
Hersteller Artikelnummer: orb578037
Alternativnummer: BYT-ORB578037-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT1A
Konjugation: Unconjugated
Alternative Synonym: MAT, SAMS, MATA1, SAMS1
Rabbit polyclonal antibody to MAT1A
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 44 kDa
NCBI: 000420
UniProt: Q00266
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
Target-Kategorie: MAT1A