PON1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578040
Artikelname: PON1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578040
Hersteller Artikelnummer: orb578040
Alternativnummer: BYT-ORB578040-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PON1
Konjugation: Unconjugated
Alternative Synonym: ESA, PON, MVCD5
Rabbit polyclonal antibody to PON1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 39kDa
NCBI: 000437
UniProt: P27169
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA
Target-Kategorie: PON1