SERPINC1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578041
Artikelname: SERPINC1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578041
Hersteller Artikelnummer: orb578041
Alternativnummer: BYT-ORB578041-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINC1
Konjugation: Unconjugated
Alternative Synonym: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2
Rabbit polyclonal antibody to SERPINC1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 000479
UniProt: P01008
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
Target-Kategorie: SERPINC1