CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB578043
Artikelname: |
CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB578043 |
Hersteller Artikelnummer: |
orb578043 |
Alternativnummer: |
BYT-ORB578043-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human, Mouse |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX |
Rabbit polyclonal antibody to CYP1A1 |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Molekulargewicht: |
58 kDa |
NCBI: |
000490 |
UniProt: |
P04798 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Target-Kategorie: |
CYP1A1 |