REN antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578046
Artikelname: REN antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578046
Hersteller Artikelnummer: orb578046
Alternativnummer: BYT-ORB578046-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human REN
Konjugation: Unconjugated
Alternative Synonym: RTD, HNFJ2, ADTKD4
Rabbit polyclonal antibody to REN
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 45kDa
NCBI: 000528
UniProt: P00797
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
Target-Kategorie: REN