SFTPB antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578047
Artikelname: SFTPB antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578047
Hersteller Artikelnummer: orb578047
Alternativnummer: BYT-ORB578047-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFTPB
Konjugation: Unconjugated
Alternative Synonym: SP-B, PSP-B, SFTB3, SFTP3, SMDP1
Rabbit polyclonal antibody to SFTPB
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 42 kDa
NCBI: 000533
UniProt: P07988
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
Target-Kategorie: SFTPB