Vtn antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578048
Artikelname: Vtn antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578048
Hersteller Artikelnummer: orb578048
Alternativnummer: BYT-ORB578048-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Vtn
Konjugation: Unconjugated
Alternative Synonym: Vn, Aa1018
Rabbit polyclonal antibody to Vtn
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 062029
UniProt: Q3KR94
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Target-Kategorie: Vtn