DDC antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578053
Artikelname: DDC antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578053
Hersteller Artikelnummer: orb578053
Alternativnummer: BYT-ORB578053-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDC
Konjugation: Unconjugated
Alternative Synonym: AADC
Rabbit polyclonal antibody to DDC
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 53kDa
NCBI: 000781
UniProt: P20711
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
Target-Kategorie: DDC