PLA2G5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578056
Artikelname: PLA2G5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578056
Hersteller Artikelnummer: orb578056
Alternativnummer: BYT-ORB578056-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5
Konjugation: Unconjugated
Alternative Synonym: FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Rabbit polyclonal antibody to PLA2G5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 14kDa
NCBI: 000920
UniProt: P39877
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
Target-Kategorie: PLA2G5