UMOD antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578065
Artikelname: UMOD antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578065
Hersteller Artikelnummer: orb578065
Alternativnummer: BYT-ORB578065-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UMOD
Konjugation: Unconjugated
Alternative Synonym: THP, FJHN, HNFJ, THGP, HNFJ1, MCKD2, ADTKD1, ADMCKD2
Rabbit polyclonal antibody to UMOD
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 67kDa
NCBI: 001008390
UniProt: P07911
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL
Target-Kategorie: UMOD