MUC1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578069
Artikelname: MUC1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578069
Hersteller Artikelnummer: orb578069
Alternativnummer: BYT-ORB578069-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Porcine
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Konjugation: Unconjugated
Alternative Synonym: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, H23AG, MCKD1, MUC-1, ADMCKD, ADTKD2, ADMCKD1, CA 15-3, MUC-1/X, MUC1/ZD, MUC-1/SEC
Rabbit polyclonal antibody to MUC1
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 22kDa
NCBI: 001037855
UniProt: Q7Z552
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Target-Kategorie: MUC1