EFEMP1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB578070
Artikelname: EFEMP1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB578070
Hersteller Artikelnummer: orb578070
Alternativnummer: BYT-ORB578070-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Konjugation: Unconjugated
Alternative Synonym: DHRD, DRAD, FBNL, MLVT, MTLV, S1-5, FBLN3, FIBL-3
Rabbit polyclonal antibody to EFEMP1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 53kDa
NCBI: 001034437
UniProt: Q12805
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV
Target-Kategorie: EFEMP1