MORC3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579596
Artikelname: MORC3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579596
Hersteller Artikelnummer: orb579596
Alternativnummer: BYT-ORB579596-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORC3
Konjugation: Unconjugated
Alternative Synonym: NXP2, ZCW5, ZCWCC3
Rabbit polyclonal antibody to MORC3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 103kDa
NCBI: 056173
UniProt: Q14149
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RLSSQFENSVYKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQSHVEQGG
Target-Kategorie: MORC3