MRPS6 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579604
Artikelname: MRPS6 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579604
Hersteller Artikelnummer: orb579604
Alternativnummer: BYT-ORB579604-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MRPS6
Konjugation: Unconjugated
Alternative Synonym: S6mt, RPMS6, MRP-S6, C21orf101
Rabbit polyclonal antibody to MRPS6
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 13 kDa
NCBI: 115865
UniProt: P82932
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Target-Kategorie: MRPS6