C21ORF58 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579606
Artikelname: C21ORF58 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579606
Hersteller Artikelnummer: orb579606
Alternativnummer: BYT-ORB579606-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21ORF58
Konjugation: Unconjugated
Rabbit polyclonal antibody to C21ORF58
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30 kDa
NCBI: 006724081
UniProt: P58505
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW
Target-Kategorie: C21ORF58