NCF4 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579617
Artikelname: NCF4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579617
Hersteller Artikelnummer: orb579617
Alternativnummer: BYT-ORB579617-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCF4
Konjugation: Unconjugated
Alternative Synonym: NCF, CGD3, P40PHOX, SH3PXD4
Rabbit polyclonal antibody to NCF4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 39kDa
NCBI: 038202
UniProt: A8K4F9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
Target-Kategorie: NCF4