GUCY1B1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB579619
| Artikelname: |
GUCY1B1 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB579619 |
| Hersteller Artikelnummer: |
orb579619 |
| Alternativnummer: |
BYT-ORB579619-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1 |
| Rabbit polyclonal antibody to GUCY1B1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
71 kDa |
| NCBI: |
000848 |
| UniProt: |
Q02153 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS |
| Target-Kategorie: |
GUCY1B1 |
