RRM2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579629
Artikelname: RRM2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579629
Hersteller Artikelnummer: orb579629
Alternativnummer: BYT-ORB579629-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RRM2
Konjugation: Unconjugated
Alternative Synonym: R2, RR2, RR2M, C2orf48
Rabbit polyclonal antibody to RRM2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 45kDa
NCBI: 001025
UniProt: P31350
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
Target-Kategorie: RRM2