RRM2B antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579630
Artikelname: RRM2B antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579630
Hersteller Artikelnummer: orb579630
Alternativnummer: BYT-ORB579630-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RRM2B
Konjugation: Unconjugated
Alternative Synonym: P53R2, MTDPS8A, MTDPS8B
Rabbit polyclonal antibody to RRM2B
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
UniProt: Q7LG56
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST
Target-Kategorie: RRM2B