IFIT3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579632
Artikelname: IFIT3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579632
Hersteller Artikelnummer: orb579632
Alternativnummer: BYT-ORB579632-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT3
Konjugation: Unconjugated
Alternative Synonym: P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG-49, GARG-49
Rabbit polyclonal antibody to IFIT3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 56 kDa
NCBI: 001026853
UniProt: O14879
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Target-Kategorie: IFIT3