KYNU antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579634
Artikelname: KYNU antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579634
Hersteller Artikelnummer: orb579634
Alternativnummer: BYT-ORB579634-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KYNU
Konjugation: Unconjugated
Alternative Synonym: KYNUU, VCRL2
Rabbit polyclonal antibody to KYNU
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 003928
UniProt: Q16719
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
Target-Kategorie: KYNU