SMC2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579639
Artikelname: SMC2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579639
Hersteller Artikelnummer: orb579639
Alternativnummer: BYT-ORB579639-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMC2
Konjugation: Unconjugated
Alternative Synonym: CAPE, CAP-E, SMC-2, SMC2L1
Rabbit polyclonal antibody to SMC2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
NCBI: 03396
UniProt: O95347
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE
Target-Kategorie: SMC2