EIF2S3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579645
Artikelname: EIF2S3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579645
Hersteller Artikelnummer: orb579645
Alternativnummer: BYT-ORB579645-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S3
Konjugation: Unconjugated
Alternative Synonym: EIF2, EIF2G, MEHMO, MRXSBRK, eIF-2gA, EIF2gamma
Rabbit polyclonal antibody to EIF2S3
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 51kDa
NCBI: 001406
UniProt: P41091
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
Target-Kategorie: EIF2S3