CTPS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579652
Artikelname: CTPS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579652
Hersteller Artikelnummer: orb579652
Alternativnummer: BYT-ORB579652-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTPS
Konjugation: Unconjugated
Alternative Synonym: CTPS, GATD5, IMD24
Rabbit polyclonal antibody to CTPS
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 67kDa
NCBI: 001896
UniProt: P17812
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Target-Kategorie: CTPS1