PPAT antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579658
Artikelname: PPAT antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579658
Hersteller Artikelnummer: orb579658
Alternativnummer: BYT-ORB579658-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAT
Konjugation: Unconjugated
Alternative Synonym: GPAT, PRAT, ATASE
Rabbit polyclonal antibody to PPAT
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 57 kDa
NCBI: 002694
UniProt: Q06203
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
Target-Kategorie: PPAT