PPAT antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579659
Artikelname: PPAT antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579659
Hersteller Artikelnummer: orb579659
Alternativnummer: BYT-ORB579659-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PPAT
Konjugation: Unconjugated
Alternative Synonym: GPAT, PRAT, ATASE
Rabbit polyclonal antibody to PPAT
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 56kDa
NCBI: 002694
UniProt: Q06203
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Target-Kategorie: PPAT