FEN1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579666
Artikelname: FEN1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579666
Hersteller Artikelnummer: orb579666
Alternativnummer: BYT-ORB579666-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Konjugation: Unconjugated
Alternative Synonym: MF1, RAD2, FEN-1
Rabbit polyclonal antibody to FEN1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 42kDa
NCBI: 004102
UniProt: P39748
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH
Target-Kategorie: FEN1