CAD antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579671
Artikelname: CAD antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579671
Hersteller Artikelnummer: orb579671
Alternativnummer: BYT-ORB579671-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAD
Konjugation: Unconjugated
Alternative Synonym: CDG1Z, DEE50, GATD4, EIEE50
Rabbit polyclonal antibody to CAD
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 243kDa
NCBI: 004332
UniProt: P27708
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
Target-Kategorie: CAD