EPRS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579674
Artikelname: EPRS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579674
Hersteller Artikelnummer: orb579674
Alternativnummer: BYT-ORB579674-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPRS
Konjugation: Unconjugated
Alternative Synonym: EARS, EPRS, PARS, QARS, QPRS, HLD15, PIG32, GLUPRORS
Rabbit polyclonal antibody to EPRS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 170kDa
NCBI: 004437
UniProt: P07814
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
Target-Kategorie: EPRS