PLK1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579680
Artikelname: PLK1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579680
Hersteller Artikelnummer: orb579680
Alternativnummer: BYT-ORB579680-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PLK1
Konjugation: Unconjugated
Alternative Synonym: PLK, STPK13
Rabbit polyclonal antibody to PLK1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 68kDa
NCBI: 005021
UniProt: P53350
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
Target-Kategorie: PLK1