SHMT2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579686
Artikelname: SHMT2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579686
Hersteller Artikelnummer: orb579686
Alternativnummer: BYT-ORB579686-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHMT2
Konjugation: Unconjugated
Alternative Synonym: GLYA, SHMT, NEDCASB, HEL-S-51e
Rabbit polyclonal antibody to SHMT2
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 56kDa
NCBI: 005403
UniProt: P34897
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
Target-Kategorie: SHMT2