SMC4 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579689
Artikelname: SMC4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579689
Hersteller Artikelnummer: orb579689
Alternativnummer: BYT-ORB579689-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMC4
Konjugation: Unconjugated
Alternative Synonym: CAPC, CAP-C, SMC-4, SMC4L1
Rabbit polyclonal antibody to SMC4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 147kDa
NCBI: 001002800
UniProt: Q9NTJ3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK
Target-Kategorie: SMC4