LMNB1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579693
Artikelname: LMNB1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579693
Hersteller Artikelnummer: orb579693
Alternativnummer: BYT-ORB579693-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LMNB1
Konjugation: Unconjugated
Alternative Synonym: LMN, ADLD, LMN2, LMNB, MCPH26
Rabbit polyclonal antibody to LMNB1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 66kDa
NCBI: 005564
UniProt: P20700
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Target-Kategorie: LMNB1