VARS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579698
Artikelname: VARS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579698
Hersteller Artikelnummer: orb579698
Alternativnummer: BYT-ORB579698-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VARS
Konjugation: Unconjugated
Alternative Synonym: G7A, VARS, VARS2, NDMSCA
Rabbit polyclonal antibody to VARS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 140kDa
NCBI: 006286
UniProt: P26640
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP
Target-Kategorie: VARS