MTHFD2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579703
Artikelname: MTHFD2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579703
Hersteller Artikelnummer: orb579703
Alternativnummer: BYT-ORB579703-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD2
Konjugation: Unconjugated
Alternative Synonym: NMDMC
Rabbit polyclonal antibody to MTHFD2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 35kDa
NCBI: 006627
UniProt: P13995
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN
Target-Kategorie: MTHFD2