PFAS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579709
Artikelname: PFAS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579709
Hersteller Artikelnummer: orb579709
Alternativnummer: BYT-ORB579709-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFAS
Konjugation: Unconjugated
Alternative Synonym: PURL, FGAMS, GATD8, FGARAT, FGAR-AT
Rabbit polyclonal antibody to PFAS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 145kDa
NCBI: 036525
UniProt: O15067
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Target-Kategorie: PFAS