MRPL15 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579713
Artikelname: MRPL15 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579713
Hersteller Artikelnummer: orb579713
Alternativnummer: BYT-ORB579713-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL15
Konjugation: Unconjugated
Alternative Synonym: L15mt, RPML7, MRP-L7, HSPC145, MRP-L15
Rabbit polyclonal antibody to MRPL15
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 33kDa
NCBI: 054894
UniProt: Q9P015
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYTS
Target-Kategorie: MRPL15