NCAPH antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579720
Artikelname: NCAPH antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579720
Hersteller Artikelnummer: orb579720
Alternativnummer: BYT-ORB579720-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH
Konjugation: Unconjugated
Alternative Synonym: CAPH, BRRN1, CAP-H, MCPH23
Rabbit polyclonal antibody to NCAPH
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 82kDa
NCBI: 056156
UniProt: Q15003
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
Target-Kategorie: NCAPH