DTL antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579730
Artikelname: DTL antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579730
Hersteller Artikelnummer: orb579730
Alternativnummer: BYT-ORB579730-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DTL
Konjugation: Unconjugated
Alternative Synonym: CDT2, RAMP, DCAF2, L2DTL
Rabbit polyclonal antibody to DTL
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 79kDa
NCBI: 057532
UniProt: Q9NZJ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
Target-Kategorie: DTL