MRPL39 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB579732
| Artikelname: |
MRPL39 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB579732 |
| Hersteller Artikelnummer: |
orb579732 |
| Alternativnummer: |
BYT-ORB579732-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL39 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
L5mt, L39mt, MRPL5, RPML5, MRP-L5, PRED22, PRED66, MSTP003, C21orf92 |
| Rabbit polyclonal antibody to MRPL39 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
39kDa |
| NCBI: |
059142 |
| UniProt: |
Q9NYK5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST |
| Target-Kategorie: |
MRPL39 |
