CEP55 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579734
Artikelname: CEP55 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579734
Hersteller Artikelnummer: orb579734
Alternativnummer: BYT-ORB579734-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CEP55
Konjugation: Unconjugated
Alternative Synonym: CT111, MARCH, URCC6, C10orf3
Rabbit polyclonal antibody to CEP55
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 54kDa
NCBI: 060601
UniProt: Q53EZ4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
Target-Kategorie: CEP55