MAGEA5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579740
Artikelname: MAGEA5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579740
Hersteller Artikelnummer: orb579740
Alternativnummer: BYT-ORB579740-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEA5
Konjugation: Unconjugated
Alternative Synonym: CT1.5, MAGE5, MAGEA4, MAGEA5
Rabbit polyclonal antibody to MAGEA5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 13
NCBI: 066387
UniProt: P43359
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL
Target-Kategorie: MAGEA5