MRPS12 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579743
Artikelname: MRPS12 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579743
Hersteller Artikelnummer: orb579743
Alternativnummer: BYT-ORB579743-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS12
Konjugation: Unconjugated
Alternative Synonym: RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12
Rabbit polyclonal antibody to MRPS12
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 12kDa
NCBI: 066930
UniProt: O15235
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK
Target-Kategorie: MRPS12