MCCC2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579747
Artikelname: MCCC2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579747
Hersteller Artikelnummer: orb579747
Alternativnummer: BYT-ORB579747-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MCCC2
Konjugation: Unconjugated
Alternative Synonym: MCCB, MCCCbeta
Rabbit polyclonal antibody to MCCC2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 071415
UniProt: Q9HCC0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR
Target-Kategorie: MCCC2